PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C026266P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 104aa    MW: 11995 Da    PI: 10.0464
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C026266P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++ +G g+W+++++  g+ R++k+c++rw +yl
   MELO3C026266P1 14 KGLWSPEEDEKLFNYITTFGVGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding23.71.1e-0767100133
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..T CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg..k 33 
                      rg ++++E++l++ +++ lG++ W+ Ia+ +   k
   MELO3C026266P1  67 RGMFSQQEEDLIISLHEVLGNR-WAQIAAQLLlrK 100
                      789*******************.*****9987444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.421965IPR017930Myb domain
SuperFamilySSF466895.24E-2411101IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002496.8E-151461IPR001005SANT/Myb domain
CDDcd001673.17E-101761No hitNo description
Gene3DG3DSA:1.10.10.606.1E-1465103IPR009057Homeodomain-like
SMARTSM007177.466103IPR001005SANT/Myb domain
PROSITE profilePS512949.70866103IPR017930Myb domain
PfamPF002492.1E-66797IPR001005SANT/Myb domain
CDDcd001670.007257099No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MGRNSCCLKP KLRKGLWSPE EDEKLFNYIT TFGVGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHEVLGNRWA QIAAQLLLRK NRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2079620108MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818148e-69LN681814.1 Cucumis melo genomic scaffold, anchoredscaffold00089.
GenBankLN7132568e-69LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138267.12e-67PREDICTED: transcription factor MYB32-like
RefseqXP_008464521.12e-67PREDICTED: transcription factor MYB32-like isoform X1
SwissprotQ8LPH62e-54MYB86_ARATH; Transcription factor MYB86
TrEMBLW9S7H64e-65W9S7H6_9R
STRINGGLYMA05G02550.22e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.35e-57myb domain protein 55